Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial

Name:Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:ERP29
Alternative Names: 
ERP29; C12orf8; ERP28Endoplasmic reticulum resident protein 29; ERp29; Endoplasmic reticulum resident protein 28; ERp28; Endoplasmic reticulum resident protein 31; ERp31


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:51.0kDa

expression region: 40-251aa

Amino acid sequence:

PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg