Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

Name:Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

Purity:>90% as determined by SDS-PAGE.

Gene name:DNASE1L3

Alternative Names: 
Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:60.4kDa

expression region:21-305aa

Amino acid sequence:
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg