Technical advantages
Recombinant Human Lymphocyte antigen 6E (LY6E)
Name:Recombinant Human Lymphocyte antigen 6E (LY6E)
Purity:>90% as determined by SDS-PAGE.
Gene name:LY6E
Alternative Names:
LY6E; 9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1
Species:Homo sapiens (Human)
Protein length:Full Length of Mature Protein
Source:E.coli
Molecular weight:24.5kDa
ex
Amino acid sequence:
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein tag: N-terminal 6xHis-SUMO-tagged
Specification:20ug/100ug/1mg
