PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Name:Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:PSMB7

Alternative Names: 
Macropain chain Z; Multicatalytic endopeptidase complex chain Z; Proteasome (prosome macropain) subunit beta type 7; Proteasome beta 7 subunit; Proteasome catalytic subunit 2; Proteasome subunit alpha; Proteasome subunit beta 7 ; Proteasome subunit beta type-7; Proteasome subunit Z; PSB7_HUMAN; PSMB7; PUP1; Z


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:52.1kDa

expression region: 44-275aa

Amino acid sequence:

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg