PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Proteasome subunit beta type-4 (PSMB4)

Name:Recombinant Human Proteasome subunit beta type-4 (PSMB4)

Purity:>90% as determined by SDS-PAGE.

Gene name:PSMB4

Alternative Names: 
26 kDa prosomal protein; HN3; HsBPROS26; HSN3; Macropain beta chain; Multicatalytic endopeptidase complex beta chain; PROS-26; PROS26; Proteasome (prosome macropain) subunit beta type 4 ; Proteasome beta 4 subunit; Proteasome beta chain; Proteasome chain 3; Proteasome subunit beta 4; Proteasome subunit beta type 4; Proteasome subunit beta type-4; Proteasome subunit HsN3; PSB4_HUMAN; PSMB 4; PSMB4


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:51.4kDa

expression region: 46-264aa

Amino acid sequence:

TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg