PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Proteasome subunit beta type-2 (PSMB2)

Name:Recombinant Human Proteasome subunit beta type-2 (PSMB2)

Purity:>90% as determined by SDS-PAGE.

Gene name:PSMB2

Alternative Names: 
HC7 I; Macropain subunit C7 I; Macropain subunit C7-I; Multicatalytic endopeptidase complex subunit C7 1; Multicatalytic endopeptidase complex subunit C7 I; Multicatalytic endopeptidase complex subunit C7-I; Proteasome (prosome, macropain) subunit beta type 2; Proteasome beta 2 subunit; Proteasome component C7 I; Proteasome component C7-I; Proteasome subunit beta type-2; PSB2_HUMAN; Psmb2


Species:Homo sapiens (Human)

Protein length:Full Length

Source:E.coli

Molecular weight:49.8kDa

expression region:1-201aa

Amino acid sequence:

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg