PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Proteasome subunit beta type-1 (PSMB1)

Name:Recombinant Human Proteasome subunit beta type-1 (PSMB1)

Purity:>90% as determined by SDS-PAGE.

Gene name:PSMB1

Alternative Names: 
FLJ25321; HC5; KIAA1838; Macropain subunit C5; Multicatalytic endopeptidase complex subunit C5; Proteasome (prosome macropain) subunit beta type 1; Proteasome beta 1 subunit; Proteasome component C5; Proteasome gamma chain; Proteasome subunit beta type 1; Proteasome subunit beta type-1; Proteasome subunit HC5; PSB1_HUMAN; PSC5; PSMB 1; PSMB1


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:50.5kDa

expression region: 29-241aa

Amino acid sequence:

RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg