Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein (SERS), partial

Name:Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein (SERS), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:SERS

Alternative Names: 
C78314; cytoplasmic; EC 6.1.1.11; FLJ36399; sarS; Sars1; Serine tRNA ligase 1, cytoplasmic; Serine tRNA ligase; Serine--tRNA ligase; serine--tRNA ligase, cytoplasmic; SerRS; SERS; Seryl tRNA Ser/Sec synthetase; Seryl tRNA synthetase; Seryl tRNA synthetase cytoplasmic; Seryl-tRNA Ser/Sec synthetase; Seryl-tRNA synthetase; seryl-tRNA synthetase, cytoplasmic; Seryl-tRNA(Ser/Sec) synthetase; Strs; SYSC_HUMAN


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:53.4kDa

expression region: 2-233aa

Amino acid sequence:

VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg