Recombinant Human Eukaryotic translation initiation factor 1 (EIF1)

Name:Recombinant Human Eukaryotic translation initiation factor 1 (EIF1)

Purity:>90% as determined by SDS-PAGE.

Gene name:EIF1

Alternative Names: 
EIF1; SUI1Eukaryotic translation initiation factor 1; eIF1; A121; Protein translation factor SUI1 homolog; Sui1iso1


Species:Homo sapiens (Human)

Protein length:Full Length

Source:E.coli

Molecular weight:39.7kDa

expression region:1-113aa

Amino acid sequence:

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg