PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Vascular endothelial growth factor C (VEGFC)

Name:Recombinant Human Vascular endothelial growth factor C (VEGFC)

Purity:>90% as determined by SDS-PAGE.

Gene name:VEGFC

Alternative Names: 
Flt 4L; Flt4 ligand; FLT4 ligand DHM; Flt4-L; Flt4L; Vascular endothelial growth factor C; Vascular endothelial growth factor related protein; Vascular endothelial growth factor-related protein; VEGF C; VEGF-C; Vegfc; VEGFC_HUMAN; VRP


Species:Homo sapiens (Human)

Protein length: Full Length of Mature Protein

Source:E.coli

Molecular weight:40.1kDa

expression region: 112-227aa

Amino acid sequence:
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Amino acid sequence:N-terminal GST-tagged

Specification:20ug/100ug/1mg