Technical advantages
Recombinant Human Vascular endothelial growth factor D (FIGF)
Name:Recombinant Human Vascular endothelial growth factor D (FIGF)
Purity:>90% as determined by SDS-PAGE.
Gene name:FIGF
Alternative Names:
c-fos induced growth factor; c-fos induced growth factor (vascular endothelial growth factor D); c-fos induced growth factor; c-fos-induced growth factor; FIGF; Vascular endothelial growth factor D; Vascular endothelial growth factor D precursor; Vascular endothelial growth factor D precursor; VEGF D; VEGF-D; VEGFD; VEGFD_HUMAN
Species:Homo sapiens (Human)
Protein length:Full Length of Mature Protein
Source:E.coli
Molecular weight:40.1kDa
ex
ex
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein tag: N-terminal GST-tagged
Specification:20ug/100ug/1mg