PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Vascular endothelial growth factor D (FIGF)

Name:Recombinant Human Vascular endothelial growth factor D (FIGF)

Purity:>90% as determined by SDS-PAGE.

Gene name:FIGF

Alternative Names: 
c-fos induced growth factor; c-fos induced growth factor (vascular endothelial growth factor D); c-fos induced growth factor; c-fos-induced growth factor; FIGF; Vascular endothelial growth factor D; Vascular endothelial growth factor D precursor; Vascular endothelial growth factor D precursor; VEGF D; VEGF-D; VEGFD; VEGFD_HUMAN


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:40.1kDa

expression region: 89-205aa

Amino acid sequence:
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg