Technical advantages
								
								
								
								
							
									Recombinant Human Sperm surface protein Sp17 (SPA17), partial								
								
								Name:Recombinant Human Sperm surface protein Sp17 (SPA17), partial
Purity:>90% as determined by SDS-PAGE.
Gene name:SPA17
	Alternative Names: 
	Band 34; Cancer/testis antigen 22; CT22; SP17 1; Sp17-1; SP17_HUMAN; SPA17; Sperm autoantigenic protein 17; Sperm protein 17; Sperm surface protein Sp17
	
Species:Homo sapiens (Human)
Protein length:Partial
Source:E.coli
Molecular weight: 43.8kDa
	ex
	Quality assurance:
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
	
	Protein tag:N-terminal GST-tagged
Specification:20ug/100ug/1mg
 
					 
			