Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Name:Recombinant Human Sperm surface protein Sp17 (SPA17), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:SPA17

Alternative Names: 
Band 34; Cancer/testis antigen 22; CT22; SP17 1; Sp17-1; SP17_HUMAN; SPA17; Sperm autoantigenic protein 17; Sperm protein 17; Sperm surface protein Sp17


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight: 43.8kDa

expression region: 1-146aa

Quality assurance:
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg