Recombinant Mouse Lymphotoxin-alpha (Lta)

Name:Recombinant Mouse Lymphotoxin-alpha (Lta)

Purity:>85% as determined by SDS-PAGE.

Gene name:Lta

Alternative Names: 
Lta; Tnfb; Tnfsf1; Lymphotoxin-alpha; LT-alpha; TNF-beta; Tumor necrosis factor ligand superfamily member 1


Species:Mus musculus (Mouse)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:23.6 kDa

expression region:34-202aa

Amino acid sequence:
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal 10xHis-tagged and C-terminal Myc-tagged

Specification:20ug/100ug/1mg