Technical advantages
Recombinant Human Ras-related protein Rab-1A (RAB1A)
Alternative Names: Recombinant Human Ras-related protein Rab-1A (RAB1A)
Purity:>90% as determined by SDS-PAGE.
Gene name:RAB1A
Alternative Names:
GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein
Species:Homo sapiens (Human)
Protein length:Full Length of Mature Protein
Source:E.coli
Molecular weight:49.5kDa
ex
Amino acid sequence:
SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein tag: N-terminal GST-tagged
Specification:20ug/100ug/1mg
