PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)

Name:Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)

Purity:>90% as determined by SDS-PAGE.

Gene name:NDUFB7

Alternative Names: 
1110002H15Rik; B18; Cell adhesion protein SQM1; CI B18; CI-B18; Complex I B18; Complex I B18 subunit; Complex I-B18; MGC2480; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 7 18kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex 7; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7; NADH ubiquinone oxidoreductase B18 subunit; NADH-ubiquinone oxidoreductase 1 beta subcomplex; 7; NADH-ubiquinone oxidoreductase B18 subunit; NDUB7_HUMAN; Ndufb7


Species:Homo sapiens (Human)

Protein length:Full Length of Mature Protein

Source:E.coli

Molecular weight:43.3kDa

expression region:2-137aa

Amino acid sequence:

GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg