PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)

Name:Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)

Purity:>90% as determined by SDS-PAGE.

Gene name:GABARAPL2

Alternative Names: 

ATG8; ATG8C; FLC3A; GABA(A) receptor-associated protein-like 2; Gabarapl2; Gamma-aminobutyric acid receptor-associated protein-like 2; Ganglioside expression factor 2; GATE-16; GATE16; GBRL2_HUMAN; GEF-2; GEF2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein


Species:Homo sapiens (Human)

Protein length:Full Length

Source:E.coli

Molecular weight:40.7kDa

expression region:1-117aa

Amino acid sequence:

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg