Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11)

Name:Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11)

Purity:>90% as determined by SDS-PAGE.

Gene name:UQCR11

Alternative Names: 
UQCR11; UQCR; Cytochrome b-c1 complex subunit 10; Complex III subunit 10; Complex III subunit XI; Ubiquinol-cytochrome c reductase complex 6.4 kDa protein


Species:Homo sapiens (Human)

Protein length:Full Length

Source:E.coli

Molecular weight:33.6kDa

expression region:1-56aa

Amino acid sequence:

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg