PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Cytochrome b-c1 complex subunit 8 (UQCRQ), partial

Name:Recombinant Human Cytochrome b-c1 complex subunit 8 (UQCRQ), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:UQCRQ

Alternative Names: 
Complex III subunit 8; Complex III subunit VIII; Cytochrome b-c1 complex subunit 8; QCR8; QCR8_HUMAN; QP-C; QPC; Ubiquinol-cytochrome c reductase complex 9.5 kDa protein; Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; Uqcrq


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:36.3kDa

expression region:2-78aa

Amino acid sequence:
GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

specification:20ug/100ug/1mg