Recombinant Human Secretory carrier-associated membrane protein 3 (SCAMP3), partial

Name:Recombinant Human Secretory carrier-associated membrane protein 3 (SCAMP3), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:SCAMP3

Alternative Names: 
C1orf3; Propin 1; Propin1; Sc3; SCAM3_HUMAN; SCAMP 3; SCAMP3; Secretory carrier associated membrane protein 3; Secretory carrier membrane protein 3; Secretory carrier-associated membrane protein 3; TU52


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:45.9kDa

expression region: 2-170aa

Amino acid sequence:
AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag:N-terminal GST-tagged

Specification:20ug/100ug/1mg