PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial

Name:Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial (NDUFV2), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:NDUFV2

Alternative Names: 
24kDa subunit of Complex I; CI-24k; complex I 24kDa subunit; complex I, mitochondrial respiratory 2; mitochondrial; NADH dehydrogenase (ubiquinone) flavoprotein 2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase [ubiquinone] flavoprotein 2; NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH ubiquinone oxidoreductase 24 kDa subunit ; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 2; NDUFV2; NDUV2_HUMAN; nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit; Ubiquinoneflavoprotein 2; Ubiquinoneflavoprotein 2, mitochondrial precursor


Species:Homo sapiens (Human)

Protein length:Partia

Source:E.coli

Molecular weight:50.6kDa

expression region: 35-249aa

Amino acid sequence:
GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein tag:N-terminal GST-tagged

Specifications:20ug/100ug/1mg