PRODUCT CATALOG
Peptide Synthesis
Compound Synthesis
Protein Expression
Antibody Preparation

Technical advantages
Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial

Name:Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial

Purity:>90% as determined by SDS-PAGE.

Gene name:GABARAP

Gene name:
ATG8A; FLC 3B; FLC3B; FLJ25768; GABA type A receptor associated protein; GABA(A) receptor associated protein; GABA(A) receptor-associated protein; GABARAP a; GABARAP; Gamma aminobutyric acid receptor associated protein; Gamma-aminobutyric acid receptor-associated protein; GBRAP_HUMAN; MGC120154; MGC120155; MM 46; MM46


Species:Homo sapiens (Human)

Protein length:Partial

Source:E.coli

Molecular weight:40.8kDa

expression region: 2-117aa

Amino acid sequence:
KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.


Protein tag: N-terminal GST-tagged

Specification:20ug/100ug/1mg