Peptide libraries are widely used in the rapidly developing proteomics and related fields, such as drug development, GPCR ligand screening, protein-protein interactions, protein functional analysis, nucleic acid binding, enzyme substrate or inhibitor screening, antigen epitope screening, messenger molecule development and peptide/protein signal response, etc., which require high-quality peptide libraries。
Main features:
Price: Our peptide library services are the most cost-effective on the market, starting as low as $20.5/peptide.
High throughput: more than 8,000 peptides per month.
Purity selection: crude peptide, desalted, > 70%, > 75%, > 80%, 85%, > 90%, > 95%, > 98%. Can meet your many needs.
Modification: including coupling, addition of special amino acids and disulfide bond ring.
Quality control: Authentic HPLC purification report and MS test report for each peptide.
No cross-contamination: The peptides synthesized in each channel are packaged independently.
Quote: After receiving your peptide library synthesis request, we will immediately give you a quote.
Scope of application:
Development of peptide vaccine T cell epitope study
Bioassay of peptides protein-peptide binding analysis
Mapping of T cell epitopes and validation of vaccine efficacy tests
Optimization and validation of T-cell assays for cell therapy
Crude peptide library
The amount of each crude peptide is 1-5mg (or 6-10mg, 11-20mg).
The peptide length is 5-20AA.
RP-HPLC purification (optional) and mass spectrometry reports are provided for each peptide.
Modifications include biotin labeling, fluorescent labeling, and non-natural amino acids.
The synthesis time is usually 2-3 weeks.
The MOQ is 48 peptides.
1 to 4mg or 6 to 10mg per peptide.
Purity selection: > 70%, > 75%, > 80%, 85%, > 90%, > 95%, > 98%.
The peptide length is 5-20AA.
HPLC and MS reports for each peptide are provided.
Modifications include biotin labeling, FITC, fluorescent labeling, and non-natural amino acids.
The synthesis time is usually 2-3 weeks.
The minimum order quantity is 48 peptides.
Peptide library types:
According to their application, peptide libraries are generally divided into:
A. Overlapping peptide libraries
Overlapping peptide libraries can be used for epitope mapping. The length of the peptide (5-15AA) and the number of offset or overlapping amino acids (2-5AA) are determined according to the length of the whole protein, the purpose of the experiment, and the cost required. Generally speaking, the shorter the peptide length, the smaller the chance of obtaining the polyantigen epitope; The higher the overlap (the smaller the offset number), the greater the chance of obtaining multiple antigen epitopes.
Example:(length 10AA, offset is 3AA)
GSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKV
GSCPQVNINF peptide 1
PQVNINFPQL peptide 2
NINFPQLGLC peptide 3
FPQLGLCRDQ peptide 4
There are 11 peptides
B.Alanine screening peptide library
Example:(length 10AA)
GSCPQVNINFpeptide 1
ASCPQVNINFpeptide2
GACPQVNINFpeptide 3
GSAPQVNINFpeptide 4
GSCAQVNINFpeptide 5
GSCPAVNINFpeptide 6
GSCPQANINFpeptide 7
GSCPQVAINFpeptide 8
GSCPQVNANFpeptide 9
GSCPQVNIAFpeptide 10
GSCPQVNINApeptide 11
C.Truncated peptide library
Truncated peptide libraries are used to identify the shortest amino acid sequence with a specific function or activity.
Example:(length 10AA) Cut off from the N terminal
GSCPQVNINF peptide 1
SCPQVNINF peptide 2
CPQVNINF peptide 3
PQVNINF peptide 4
QVNINF peptide 5
VNINF peptide 6
NINF peptide 7
The truncated peptide library can also be cut off from the C-terminal.
D.Random/messy peptide library
Chaotic peptide libraries are constructed by transforming the sequence of original peptides.The number of each amino acid in the peptide (such as 2 asparagines) is the same, it is just that the position of it and the remaining amino acids is random. The goal is to initially identify peptides that may have a specific function or activity within a set of active sequences.
GSCPQVNINF peptide 1（control peptide with full function）
SCPNINFGQV peptide 2
VFGSCPNINQ peptide 3
and so on……
E.Localization and screening of peptide libraries
In a peptide sequence, one or more amino acid positions are systematically replaced by natural amino acids (20) or other amino acids to determine which amino acid will make the peptide most active at a particular location.
Example: (length of 10AA, replace the fifth amino acid - glutamine)
GSCPQVNINF peptide 1
GSCPAVNINF peptide 2
GSCPCVNINF peptide 3
GSCPDVNINF peptide 4
GSCPEVNINF peptide 5
GSCPFVNINF peptide 6
GSCPMVNINF peptide 7
Peptide Library quotation: Our company synthesizes peptide libraries through a unique synthesis platform, providing 1-2mg of peptides for your fast and effective screening experiments. Please contact us if you want to customize your peptide library and need help with peptide library design.
